PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P04900_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 715aa    MW: 79367.3 Da    PI: 6.3039
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P04900_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.4e-2087142156
                             TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                             +++ +++t++q++eLe++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R++ k
  GSMUA_Achr10P04900_001  87 KKQYHRHTQHQIQELEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQTK 142
                             688999***********************************************998 PP

2START174.85.2e-552494642206
                             HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
                   START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                             la  a++el ++a ++ep+W+       e++ +de++++f+++ +      ++ea r +++v+m+ ++lve l+d++ qW++ +   
  GSMUA_Achr10P04900_001 249 LAVVAMEELTRMARLSEPLWTMKHgdsfEILSEDEYVRNFPRGIGpkplgMKSEATRQTAAVIMNRVNLVEMLMDVN-QWSNVFSgi 334
                             667799***************999999***************999********************************.********* PP

                             ..EEEEEEEECTT..EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECT CS
                   START  78 ..kaetlevissg..galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksn 159
                               ka tle+ +        +m+ae+q++splvp R+ +fvRy++ + +g+w++vdvS+d  ++p     v+R++++pSg+li++++n
  GSMUA_Achr10P04900_001 335 vsKAITLERTRMKllILNSQMTAEFQVPSPLVPtREILFVRYCKHQADGSWAVVDVSLDTLRPPL----VARCRRRPSGCLIQEMPN 417
                             99999999999996555579******************************************985....8***************** PP

                             CEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                   START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                             g+skvtwveh+++++ ++h ++++lv+sgla+ga +w   l+rqce+
  GSMUA_Achr10P04900_001 418 GYSKVTWVEHAEVDDGSVHDIYKPLVNSGLAFGATRWIGSLDRQCER 464
                             *********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.6E-2272138IPR009057Homeodomain-like
SuperFamilySSF466891.25E-1977145IPR009057Homeodomain-like
PROSITE profilePS5007117.10384144IPR001356Homeobox domain
SMARTSM003891.1E-1886148IPR001356Homeobox domain
CDDcd000865.11E-1987145No hitNo description
PfamPF000463.6E-1887142IPR001356Homeobox domain
PROSITE patternPS000270119142IPR017970Homeobox, conserved site
PROSITE profilePS5084842.736239467IPR002913START domain
SuperFamilySSF559617.14E-29241466No hitNo description
CDDcd088753.20E-103243463No hitNo description
SMARTSM002344.3E-45248464IPR002913START domain
PfamPF018522.3E-44250464IPR002913START domain
Gene3DG3DSA:3.30.530.204.0E-5361464IPR023393START-like domain
SuperFamilySSF559611.04E-21485706No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
MIPATHVASM IGMNRSAEYQ SSAALSLGQE PPFQYQHQHQ LVEIPQTAVA EIEMPTVRDD  60
EFETKSFGDN IENASEDDRD GNQRPRKKQY HRHTQHQIQE LEAFFKECPH PDDKQRKELS  120
RELGLEPLQV KFWFQNKRTQ TKNHQERHEN SRLRAENEKL RAENLRYKEA LSNASCPNCG  180
GPSSLGEMSF DEHQLRIDNS RLREEYVGKP VVPHQLFSPM AESDMLGAGD LLGSMFGHRE  240
IEKPVVIELA VVAMEELTRM ARLSEPLWTM KHGDSFEILS EDEYVRNFPR GIGPKPLGMK  300
SEATRQTAAV IMNRVNLVEM LMDVNQWSNV FSGIVSKAIT LERTRMKLLI LNSQMTAEFQ  360
VPSPLVPTRE ILFVRYCKHQ ADGSWAVVDV SLDTLRPPLV ARCRRRPSGC LIQEMPNGYS  420
KVTWVEHAEV DDGSVHDIYK PLVNSGLAFG ATRWIGSLDR QCERLASLMA SNVPSGDITV  480
ITTAEGRKCM LRLAERMVTS FCGGVSASTA HQWTTVSGNG AEDVRVMTRK SVGDPGRPPG  540
IVLNAAKSFW LPVPPKRVFD FLRDERSRNE WDILSNGGGV QEMAHIANGR DHGNCVSLLR  600
VNSVKSSQSN MLILQESCTD PVVSYVIYAP VDVVAMNVVL NGGDPDYVAL LPSGFAILPD  660
GASAAQGSLV TVAFEILVDS VPTAKISLGS VATVNSLIAC TVERIKAALV GENVA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009420270.10.0PREDICTED: homeobox-leucine zipper protein ROC2-like
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLM0RFG70.0M0RFG7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P04900_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2